ACTH (7-38) (human)
ACTH (7-38) (human)
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-602 | 1mg | 115.00 | + Add to cart |
|
R-M-602 | 5mg | 450.00 | + Add to cart |
|
|
Product description
ACTH (7-38) (human),CAS: 68563-24-6 from ruixi.ACTH (7-38) or Corticotropin Inhibiting Peptide (CIP) (7-38) is a fragment of Adrenocorticotropic Hormone which inhibits ACTH stimulated adenylate cyclase. It can acts as an antagonist of ACTH receptors.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >95% |
Solubility | N/A |
Cas | 68563-24-6 |
Sequence | FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE |
Synonyms | Corticotropin-Inhibiting Peptide (CIP) |
Molecular Formula | C₁₆₇H₂₅₇N₄₇O₄₆ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product